SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471530 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000471530
Domain Number - Region: 65-95
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000112
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471530   Gene: ENSG00000099783   Transcript: ENST00000600806
Sequence length 99
Comment pep:known chromosome:GRCh38:19:8444977:8489110:1 gene:ENSG00000099783 transcript:ENST00000600806 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNR
FEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKGMCCC
Download sequence
Identical sequences A0A2J8J6L9 M0R0Y6
ENSP00000471530 ENSP00000471530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]