SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471841 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471841
Domain Number 1 Region: 1-45
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.00000239
Family Choline/Carnitine O-acyltransferase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471841   Gene: ENSG00000169169   Transcript: ENST00000597099
Sequence length 81
Comment pep:putative chromosome:GRCh38:19:49712993:49713731:1 gene:ENSG00000169169 transcript:ENST00000597099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKE
NSRHSRQLASPRNKGEIATAG
Download sequence
Identical sequences A0A2J8J0S4 M0R1F9
ENSP00000471841 ENSP00000471841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]