SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471950 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471950
Domain Number 1 Region: 21-106
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000871
Family N-terminal domain of adrenodoxin reductase-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471950   Gene: ENSG00000104951   Transcript: ENST00000596022
Sequence length 106
Comment pep:known chromosome:GRCh38:19:49895815:49929496:-1 gene:ENSG00000104951 transcript:ENST00000596022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNDDFCPGLTIKAMGAERAPQRQPCTLHLLVLVPILLSLVASQDWKAERSQDPFEKCMQ
DPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHK
Download sequence
Identical sequences M0R1L1
ENSP00000471950 ENSP00000471950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]