SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000472362 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000472362
Domain Number - Region: 17-78
Classification Level Classification E-value
Superfamily MIT domain 0.00647
Family MIT domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472362   Gene: ENSG00000053501   Transcript: ENST00000595101
Sequence length 135
Comment pep:known chromosome:GRCh38:19:17215388:17218826:1 gene:ENSG00000053501 transcript:ENST00000595101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINE
YSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSE
MRSELLGTDSAGESP
Download sequence
Identical sequences A0A2J8LTV1
ENSP00000472362 ENSP00000472362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]