SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000472376 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472376
Domain Number 1 Region: 48-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.54e-31
Family Forkhead DNA-binding domain 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472376   Gene: ENSG00000176678   Transcript: ENST00000593625
Sequence length 114
Comment pep:known chromosome:GRCh38:16:86576368:86579066:1 gene:ENSG00000176678 transcript:ENST00000593625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAM
AIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREK
Download sequence
Identical sequences A0A2J8LF25 A0A2J8T9F3 M0R279
ENSP00000472376 ENSP00000472376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]