SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000472602 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472602
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Sec7 domain 5.36e-69
Family Sec7 domain 0.000000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472602   Gene: ENSG00000105443   Transcript: ENST00000595765
Sequence length 214
Comment pep:putative chromosome:GRCh38:19:48472352:48475148:1 gene:ENSG00000105443 transcript:ENST00000595765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQF
LWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDK
PGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLL
KLGTCPPDPAGPSAGGHLWAWALDSASAHTCCLN
Download sequence
Identical sequences M0R2J0
ENSP00000472602 ENSP00000472602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]