SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473226 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473226
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0000419
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473226   Gene: ENSG00000130517   Transcript: ENST00000597663
Sequence length 110
Comment pep:putative chromosome:GRCh38:19:18357478:18369930:1 gene:ENSG00000130517 transcript:ENST00000597663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRKKPFPAKGDCVFC
RRRRARSLQAQCGFSLTPALELLPVPFLKLLCPGPPRRRRICRILPGAGL
Download sequence
Identical sequences M0R3H3
ENSP00000473226 ENSP00000473226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]