SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473772 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473772
Domain Number 1 Region: 6-146
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 2.22e-41
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473772   Gene: ENSG00000130517   Transcript: ENST00000604499
Sequence length 171
Comment pep:putative chromosome:GRCh38:19:18340598:18363678:1 gene:ENSG00000130517 transcript:ENST00000604499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPA
LWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCKRVTTLGLDVSVTISQDAGRVTVDQPSSTCPHWGSRTTRTSWAGH
Download sequence
Identical sequences A0A2J8LT86 S4R2Y9
NP_001295295.1.87134 NP_001295295.1.92137 XP_012364818.1.23891 XP_014198065.1.60992 XP_016790999.1.37143 XP_018872052.1.27298 ENSP00000473772 ENSP00000473772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]