SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475153 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475153
Domain Number 1 Region: 106-145
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.76e-16
Family Leucine zipper domain 0.00043
Further Details:      
 
Domain Number 2 Region: 65-108
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 0.000000012
Family A DNA-binding domain in eukaryotic transcription factors 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475153   Gene: ENSG00000130522   Transcript: ENST00000600972
Sequence length 166
Comment pep:putative chromosome:GRCh38:19:18280019:18280929:-1 gene:ENSG00000130522 transcript:ENST00000600972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQT
VPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKS
QNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQREEQSVRF
Download sequence
Identical sequences A0A2J8LTB5 A0A2J8T615 U3KPR5
ENSP00000475153 ENSP00000475153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]