SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475364 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475364
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 2.62e-47
Family Triosephosphate isomerase (TIM) 0.000000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475364   Gene: ENSG00000111669   Transcript: ENST00000493987
Sequence length 113
Comment pep:known chromosome:GRCh38:12:6868141:6870090:1 gene:ENSG00000111669 transcript:ENST00000493987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEK
VVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKS
Download sequence
Identical sequences A0A2J8JEK0 A0A2J8TBG4 U3KPZ0
ENSP00000475260 ENSP00000475364 ENSP00000475364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]