SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000475473
Domain Number - Region: 42-61,89-122
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0138
Family Di-heme elbow motif 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475473   Gene: ENSG00000258289   Transcript: ENST00000607599
Sequence length 140
Comment pep:known chromosome:GRCh38:14:64914361:64935368:1 gene:ENSG00000258289 transcript:ENST00000607599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVC
SKRDFMLITNKSLKEEDGEEIVTYDPDLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCG
KAEDTISILPDDPRQMTLLF
Download sequence
Identical sequences A0A2I3RRC4
ENSP00000475473 ENSP00000475473 ENSP00000446697 gi|323276620|ref|NP_660148.3| NP_660148.3.87134 NP_660148.3.92137 XP_003314425.1.37143 XP_008976009.1.60992 XP_012359836.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]