SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475728 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475728
Domain Number 1 Region: 36-120
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.57e-19
Family Thioesterases 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475728   Gene: ENSG00000206329   Transcript: ENST00000469411
Sequence length 132
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:32111798:32120204:1 gene:ENSG00000206329 transcript:ENST00000469411 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLGLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQDGTVWRHG
LLEVAVPHLHAV
Download sequence
Identical sequences A0A0G2JLK6
ENSP00000435988 ENSP00000475728 ENSP00000435988 ENSP00000475728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]