SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475812 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475812
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.02e-18
Family Papain-like 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475812   Gene: ENSG00000163131   Transcript: ENST00000483930
Sequence length 117
Comment pep:known chromosome:GRCh38:1:150732838:150751834:-1 gene:ENSG00000163131 transcript:ENST00000483930 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
IIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVG
VDARHPSFFLYRSDGVLLCCQAGVRWHDLSSLQPLPPGFKQFSCLSLLSSWDYRCLL
Download sequence
Identical sequences U3KQE7
ENSP00000475812 ENSP00000475812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]