SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475847 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475847
Domain Number 1 Region: 259-517
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.95e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 122-264
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.22e-35
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0019
Further Details:      
 
Domain Number 3 Region: 519-627
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.83e-26
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000589
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475847   Gene: ENSG00000143374   Transcript: ENST00000606933
Sequence length 636
Comment pep:known chromosome:GRCh38:1:150487420:150507284:1 gene:ENSG00000143374 transcript:ENST00000606933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPV
LERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEEKVTGPTATVYGCGTLVDLC
QGPHLRHTGQIGGLKLLSAEYAHRGFSEVKTPTLFSTKLWEQSGHWEHYQEDMFAVQPPG
SDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEAS
GGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFL
GDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQ
LPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVG
SEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVN
IRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
Download sequence
Identical sequences A0A2I3RII6 U3KQG0
ENSP00000475847 ENSP00000475847 NP_001258824.1.87134 NP_001258824.1.92137 XP_009428714.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]