SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477588 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477588
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-38
Family Protein kinases, catalytic subunit 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477588   Gene: ENSG00000149554   Transcript: ENST00000531607
Sequence length 111
Comment pep:putative chromosome:GRCh38:11:125626749:125633193:1 gene:ENSG00000149554 transcript:ENST00000531607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG
MPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLA
Download sequence
Identical sequences A0A2J8N1H3 A0A2J8WZZ5
ENSP00000477588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]