SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477907 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477907
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 4.04e-59
Family Nucleosome core histones 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477907   Gene: ENSG00000273703   Transcript: ENST00000621112
Sequence length 126
Comment pep:known chromosome:GRCh38:6:27815044:27815424:1 gene:ENSG00000273703 transcript:ENST00000621112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A2I2Y3S5 A0A2I3GWH1 A0A2I3T8D8 H2PI87 Q99879
ENSPPYP00000018278 9600.ENSPPYP00000018278 9606.ENSP00000352442 ENSP00000352442 NP_003512.1.87134 NP_003512.1.92137 XP_002816623.1.23681 XP_003272005.1.23891 XP_003829741.1.60992 XP_004043514.1.27298 XP_016810553.1.37143 ENSGGOP00000002900 ENSNLEP00000022654 ENSP00000352442 ENSNLEP00000022654 ENSPPYP00000018278 gi|4504263|ref|NP_003512.1| ENSGGOP00000002900 ENSP00000477907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]