SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477938 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477938
Domain Number 1 Region: 97-202
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.22e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00023
Further Details:      
 
Domain Number 2 Region: 884-1230
Classification Level Classification E-value
Superfamily RNI-like 1.47e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.015
Further Details:      
 
Domain Number 3 Region: 301-454
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000337
Family Extended AAA-ATPase domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477938   Gene: ENSG00000278613   Transcript: ENST00000618877
Sequence length 1241
Comment pep:known chromosome:GRCh38:CHR_HSCHR5_2_CTG1_1:69603291:69659159:1 gene:ENSG00000278613 transcript:ENST00000618877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLHIGDFVWDSKVHSLQSSLNIFSLLPTKGRTEHLFFSHILSFHWPAFSSIRLELWINL
RCEFLRSKKSSEEITQYIQSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRL
DSFKDWPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNC
PFLQNMKSSAEVTPDLQSRGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKN
LNEQLRAAYTSASFRHMSLLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNL
NSVMCVEGEAGSGKTVLLKKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQ
LLEKEGSVTEMCMRNIIQQLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVR
TNRARDIRRYLETILEIKAFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTP
LFVAAICAHWFQYPFDPSFDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFS
CCFEFNDDDLAEAGVDEDEDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDS
DRQEHQDLGLYHLKQINSPMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLE
NISENDDYLKHQPEISLQMQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSP
FVLQFLQGRTLTLGALNLQYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQ
VPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCL
EVDVNDIDVVGQDMLEILMTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISK
LELSAAEQELLLTLPSLESLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSVIP
EEFPNFHHMEKLLIQISAEYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKK
LTEIKFSDSFFQAVPFVASLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELIL
PTGDGIYRVAKLIIQQCQQLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSIN
HKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNML
SWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK
Download sequence
Identical sequences A0A0G2JNC7
gi|341916267|ref|XP_003403437.1| ENSP00000477938 ENSP00000481094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]