SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478553 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478553
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000301
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478553   Gene: ENSG00000134779   Transcript: ENST00000614939
Sequence length 232
Comment pep:known chromosome:GRCh38:18:36780027:36829216:-1 gene:ENSG00000134779 transcript:ENST00000614939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKPKGSEGRSKRGCF
Download sequence
Identical sequences A0A087WUC8 A0A2I2ZD61 A0A2I3RE30
ENSP00000478553 NP_001258885.1.87134 NP_001258885.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]