SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000479075 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479075
Domain Number 1 Region: 153-241
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.36e-33
Family Inhibitor of apoptosis (IAP) repeat 0.0000997
Further Details:      
 
Domain Number 2 Region: 259-364
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.49e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 47-135
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.89e-24
Family Inhibitor of apoptosis (IAP) repeat 0.00081
Further Details:      
 
Domain Number 4 Region: 976-1318
Classification Level Classification E-value
Superfamily RNI-like 6.67e-24
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Domain Number 5 Region: 463-616
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000372
Family Extended AAA-ATPase domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479075   Gene: ENSG00000276068   Transcript: ENST00000615009
Sequence length 1347
Comment pep:known chromosome:GRCh38:CHR_HSCHR5_1_CTG1_1:70313835:70364512:-1 gene:ENSG00000276068 transcript:ENST00000615009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSE
AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRF
HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV
LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSEEITQYI
QSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA
KAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQS
RGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLL
KKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCMRNIIQ
QLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIK
AFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTPLFVAAICAHWFQYPFDPS
FDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDED
EDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYHLKQINS
PMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNL
QYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEW
ERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEIL
MTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLE
SLEVSGTIQSQVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSDSFFQAV
PFVASLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLII
QQCQQLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQA
LDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNV
MKERHPQSKYLTILQKWILPFSPIIQK
Download sequence
Identical sequences B7ZLE8
gi|341916265|ref|XP_003403436.1| ENSP00000461836 ENSP00000479075 ENSP00000483012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]