SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000479204 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479204
Domain Number 1 Region: 29-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.2e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479204   Gene: ENSG00000234078   Transcript: ENST00000618059
Sequence length 243
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:30933379:30936813:1 gene:ENSG00000234078 transcript:ENST00000618059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDCSMGVWASWQMVWWGWMTLGRVRSCGSGQAMTMWDGATTASPVAMWRWSLS
LTG
Download sequence
Identical sequences A0A2I2ZKI8 A0A2I3RBE3
ENSP00000365759 ENSP00000421978 ENSP00000479195 ENSP00000479204 ENSP00000484013 ENSP00000484588 ENSP00000405998 ENSP00000421978 ENSP00000447474 ENSP00000448115 ENSP00000449238 ENSP00000449307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]