SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000479439 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479439
Domain Number 1 Region: 92-195
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-17
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479439   Gene: ENSG00000089091   Transcript: ENST00000476058
Sequence length 225
Comment pep:putative chromosome:GRCh38:20:18383367:18394703:-1 gene:ENSG00000089091 transcript:ENST00000476058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTQSLIKDLKNLYLNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRI
KNFKTKTFQEKKEQLIPENRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITV
AVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKN
AGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC
Download sequence
Identical sequences A0A087WVH4
ENSP00000479439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]