SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000479638 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479638
Domain Number 1 Region: 148-464
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.16e-129
Family Transglutaminase core 0.00000000697
Further Details:      
 
Domain Number 2 Region: 5-147
Classification Level Classification E-value
Superfamily E set domains 7e-41
Family Transglutaminase N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 620-718
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.12e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 4 Region: 507-618
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-27
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479638   Gene: ENSG00000104055   Transcript: ENST00000622115
Sequence length 721
Comment pep:known chromosome:GRCh38:15:43233158:43260600:-1 gene:ENSG00000104055 transcript:ENST00000622115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAPGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIF
VVETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKI
HIDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPC
PWNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLN
GNWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVI
TNFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPAYGGWQVL
DATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQD
TSSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQ
PSRPTSLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDL
KVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISAL
GEEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEG
SGLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFA
L
Download sequence
Identical sequences A0A087WVS3
ENSP00000479638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]