SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000479836 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479836
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily vWA-like 0.00000000035
Family Integrin A (or I) domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479836   Gene: ENSG00000274209   Transcript: ENST00000619553
Sequence length 61
Comment pep:putative chromosome:GRCh38:10:46286345:46296094:1 gene:ENSG00000274209 transcript:ENST00000619553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVEETVARFQSPNIRMCFITYSTDGQTVLPLTSDKNRIKNGLDQLQKIVPDGHTFMQAG
F
Download sequence
Identical sequences A0A087WW08
ENSP00000458076 ENSP00000479836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]