SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480268 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480268
Domain Number 1 Region: 12-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-27
Family Dual specificity phosphatase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480268   Gene: ENSG00000112425   Transcript: ENST00000611340
Sequence length 193
Comment pep:known chromosome:GRCh38:6:145625312:145721742:-1 gene:ENSG00000112425 transcript:ENST00000611340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDI
VQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEK
GHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKRPAVYIDEEALARAQEDFF
QKFGKVRSSVCSL
Download sequence
Identical sequences A0A2J8PSA2 A0A2J8XA42 H0UI04
ENSP00000480268 XP_011534418.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]