SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480305 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480305
Domain Number 1 Region: 13-104
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-39
Family SCAN domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 186-242
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000628
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 6 Region: 319-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000249
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480305   Gene: ENSG00000106261   Transcript: ENST00000620510
Sequence length 527
Comment pep:known chromosome:GRCh38:7:100023408:100041688:1 gene:ENSG00000106261 transcript:ENST00000620510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGQDSTLQDTPPPDPEIFRQRFRRFCYQNTFGPREALSRLKELCHQWLRPEINTKEQIL
ELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARG
MVPLDPVQESSSFDLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMAS
ALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEE
STSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGK
DKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHK
IIHTGEKPYECSECGKAFSLNSNLVLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHS
GEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKP
YKCTKCGKAFTRSSTLTLHHRIHARERASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences E9PC66
NP_001273983.1.87134 NP_001273983.1.92137 ENSP00000409172 ENSP00000480305 ENSP00000409172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]