SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480370 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480370
Domain Number 1 Region: 177-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-83
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 86-185
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-16
Family Hepsin, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 39-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480370   Gene: ENSG00000137648   Transcript: ENST00000610964
Sequence length 422
Comment pep:known chromosome:GRCh38:11:118077096:118118450:1 gene:ENSG00000137648 transcript:ENST00000610964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPCANPVSPWRPSERWIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHFIPRKQ
LCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEAL
AETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLA
CGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFN
WKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFD
EELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGI
PEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKA
EL
Download sequence
Identical sequences ENSP00000480370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]