SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480393 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000480393
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily WW domain 0.000297
Family WW domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480393   Gene: ENSG00000140575   Transcript: ENST00000560373
Sequence length 107
Comment pep:putative chromosome:GRCh38:15:90467482:90473078:1 gene:ENSG00000140575 transcript:ENST00000560373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLI
TRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQVFQNLSHRQQAGI
Download sequence
Identical sequences A0A087WWP1 A0A2J8L6F3 A0A2J8VX93
ENSP00000480393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]