SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480521 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480521
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily SRP19 9.94e-35
Family SRP19 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480521   Gene: ENSG00000153037   Transcript: ENST00000445150
Sequence length 104
Comment pep:putative chromosome:GRCh38:5:112861332:112865219:1 gene:ENSG00000153037 transcript:ENST00000445150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKLV
Download sequence
Identical sequences A0A087WWU9
ENSP00000480521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]