SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480584 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480584
Domain Number 1 Region: 66-301
Classification Level Classification E-value
Superfamily Caspase-like 1.77e-100
Family Caspase catalytic domain 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480584   Gene: ENSG00000165806   Transcript: ENST00000621345
Sequence length 303
Comment pep:known chromosome:GRCh38:10:113679162:113730907:1 gene:ENSG00000165806 transcript:ENST00000621345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
Download sequence
Identical sequences P55210
NP_001218.1.87134 NP_001218.1.92137 NP_001253985.1.87134 NP_001253985.1.92137 NP_203125.1.87134 NP_203125.1.92137 ENSP00000298701 ENSP00000358321 ENSP00000358324 ENSP00000480584 gi|15718700|ref|NP_203125.1| gi|4502581|ref|NP_001218.1| 5v6u_A 5v6u_B 5v6z_A 5v6z_B ENSP00000298701 ENSP00000358321 ENSP00000358324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]