SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481183 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481183
Domain Number 1 Region: 34-278
Classification Level Classification E-value
Superfamily vWA-like 8.34e-87
Family Integrin A (or I) domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 276-363
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-23
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 527-610
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.02e-18
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 485-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 5 Region: 443-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSP00000481183
Domain Number - Region: 410-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481183   Gene: ENSG00000115221   Transcript: ENST00000620391
Sequence length 693
Comment pep:known chromosome:GRCh38:2:160099667:160200313:-1 gene:ENSG00000115221 transcript:ENST00000620391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNDHVQGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKEL
GSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILP
LTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSH
FGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQV
HLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICN
NGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCD
CQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRG
DCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCN
CTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHL
SAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIH
SINEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQ
TGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
Download sequence
Identical sequences A0A087WXP3
ENSP00000481183 NP_001269283.1.87134 NP_001269283.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]