SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481226 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481226
Domain Number 1 Region: 145-381
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.08e-57
Family Transglutaminase core 0.0000128
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 1.75e-42
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 515-613
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 
Domain Number 4 Region: 401-513
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-28
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481226   Gene: ENSG00000166947   Transcript: ENST00000622454
Sequence length 619
Comment pep:known chromosome:GRCh38:15:43197235:43221125:-1 gene:ENSG00000166947 transcript:ENST00000622454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVA
LTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLL
LQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWD
FGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGA
LLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGG
RLLIDEYYNEEGLQNGEGQRGRIWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDIT
QNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQ
ISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNF
ERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQN
SLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNM
FQNLTNYKSVTVVAPELSA
Download sequence
Identical sequences ENSP00000481226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]