SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481250 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481250
Domain Number 1 Region: 163-333
Classification Level Classification E-value
Superfamily Sec7 domain 9.03e-56
Family Sec7 domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 371-492
Classification Level Classification E-value
Superfamily PH domain-like 2.23e-27
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481250   Gene: ENSG00000059915   Transcript: ENST00000611678
Sequence length 645
Comment pep:known chromosome:GRCh38:10:102402617:102419727:-1 gene:ENSG00000059915 transcript:ENST00000611678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSYTSLASLEALASPGPTQSPF
FTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQRGEEEEAEARAKLAPGREP
PSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLALGSTDTLSNGQKADLEAAQ
RLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALM
GETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFI
GNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGS
GSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQK
EEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQS
WITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELR
EHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKLKAGSEELDAVEAALAQ
AGSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSGRRKP
Download sequence
Identical sequences A0A2J8PD02 M3ZBY0
NP_001257895.1.87134 NP_001257895.1.92137 ENSP00000481250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]