SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481793 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481793
Domain Number 1 Region: 321-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.36e-25
Family Intermediate filament protein, coiled coil region 0.0000415
Further Details:      
 
Domain Number 2 Region: 91-126
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000171
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSP00000481793
Domain Number - Region: 211-319
Classification Level Classification E-value
Superfamily Prefoldin 0.0201
Family Prefoldin 0.014
Further Details:      
 
Domain Number - Region: 12-38
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0207
Family Phosphoglucomutase, C-terminal domain 0.0045
Further Details:      
 
Domain Number - Region: 99-184
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0405
Family Mitotic arrest deficient-like 1, Mad1 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481793   Gene: ENSG00000148798   Transcript: ENST00000616853
Sequence length 496
Comment pep:known chromosome:GRCh38:10:103277167:103290342:1 gene:ENSG00000148798 transcript:ENST00000616853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGASAQSLSRSNVASSAACSSASSLG
LGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRA
LEAELARCDSHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARC
EEESRGRERRARLKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQ
ASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAARSTE
AIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLEN
DLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNP
SYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKK
TEKSNIEETTISSQKI
Download sequence
Identical sequences ENSP00000481793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]