SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481929 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481929
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily DEATH domain 8.01e-20
Family Caspase recruitment domain, CARD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481929   Gene: ENSG00000106144   Transcript: ENST00000619992
Sequence length 108
Comment pep:known chromosome:GRCh38:7:143288215:143307695:1 gene:ENSG00000106144 transcript:ENST00000619992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALHS
Download sequence
Identical sequences A0A087WYM1 A0A2I2YH13 A0A2I3S1J4
gi|39995061|ref|NP_116765.2| ENSP00000340030 ENSP00000481929 ENSP00000340030 NP_116765.2.87134 NP_116765.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]