SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482467 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482467
Domain Number 1 Region: 5-198
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.66e-59
Family CRAL/TRIO domain 0.00000000249
Further Details:      
 
Domain Number 2 Region: 202-322
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.96e-38
Family Supernatant protein factor (SPF), C-terminal domain 0.000000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482467   Gene: ENSG00000100003   Transcript: ENST00000617837
Sequence length 329
Comment pep:putative chromosome:GRCh38:22:30396992:30423838:1 gene:ENSG00000100003 transcript:ENST00000617837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRKVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQE
CAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKA
PKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKC
KSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADV
GFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHA
KKVNFTVEVLLPDKASEEKMKQLGAGTPK
Download sequence
Identical sequences B3KRD8
ENSP00000482467 ENSP00000383993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]