SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482582 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482582
Domain Number 1 Region: 49-225
Classification Level Classification E-value
Superfamily Sec7 domain 2.88e-46
Family Sec7 domain 0.0000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482582   Gene: ENSG00000164117   Transcript: ENST00000620592
Sequence length 232
Comment pep:known chromosome:GRCh38:4:174236658:174284251:-1 gene:ENSG00000164117 transcript:ENST00000620592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLTFAWLHVFGRTLRMMNFSGKGCANPWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFN
ANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRN
QFLPNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSL
ILLSIDLTSPHVKNKMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences ENSP00000482582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]