SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482588 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482588
Domain Number 1 Region: 14-302
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.77e-45
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482588   Gene: ENSG00000174946   Transcript: ENST00000617554
Sequence length 319
Comment pep:known chromosome:GRCh38:3:151198427:151199386:-1 gene:ENSG00000174946 transcript:ENST00000617554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTAD
FLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSC
KIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLT
NFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINILLVTTGYIICFVPYH
IVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRSKVTETF
ASPKETKAQKEKLRCENNA
Download sequence
Identical sequences A0A2K6NIB3 G3QEB1 H2QNL2 O14626
ENSP00000308479 ENSGGOP00000000603 ENSGGOP00000000603 gi|153792776|ref|NP_037440.3| ENSP00000308479 ENSPTRP00000026749 ENSPTRP00000026749 9598.ENSPTRP00000026749 9606.ENSP00000308479 ENSP00000308479 ENSP00000482588 NP_037440.3.87134 NP_037440.3.92137 XP_003950265.1.37143 XP_004037904.1.27298 XP_005247459.1.92137 XP_005247460.1.92137 XP_010368883.1.97406 XP_010368884.1.97406 XP_016797657.1.37143 XP_016797658.1.37143 XP_016861763.1.92137 XP_017710432.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]