SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482686 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482686
Domain Number 1 Region: 194-226,265-331
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482686   Gene: ENSG00000147606   Transcript: ENST00000617078
Sequence length 355
Comment pep:known chromosome:GRCh38:8:91218888:91398152:1 gene:ENSG00000147606 transcript:ENST00000617078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCIP
SAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGML
IQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSIK
NMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDIS
KCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGRS
VDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
Download sequence
Identical sequences A0A087WZI7
NP_001269286.1.87134 NP_001269286.1.92137 ENSP00000482686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]