SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482751 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482751
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.15e-48
Family Rhodopsin-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482751   Gene: ENSG00000172154   Transcript: ENST00000618695
Sequence length 184
Comment pep:putative chromosome:GRCh38:11:56093308:56094240:1 gene:ENSG00000172154 transcript:ENST00000618695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTVLGNLGLITLIRMDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKALVNFQSNRRSISFVGCFVQMYFFVGLVCCECFLLGSMAY
NRYIAICNPLLYSVVMSQKVSNWLGVMPYVIGFTSSLISVWVISSLAFCDSSINHFFCDT
TALL
Download sequence
Identical sequences ENSP00000482751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]