SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483180 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483180
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.38e-21
Family Pancreatic carboxypeptidases 0.00011
Further Details:      
 
Domain Number 2 Region: 139-169
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000196
Family Carboxypeptidase regulatory domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483180   Gene: ENSG00000121898   Transcript: ENST00000615851
Sequence length 224
Comment pep:known chromosome:GRCh38:10:123713276:123891984:-1 gene:ENSG00000121898 transcript:ENST00000615851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKIPFVLGGNLQGGELVVAYPYDLVRSPWKTQEHTPTPDDHVFRWLAYSYASTHRLMTD
ARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYLHTNCFELSIYVGCDKYPHESQLPE
EWENNRESLIVFMEQVHRGIKGLVRDSHGKGIPNAIISVEGINHDIRTGRVSLQKLSLAC
RRVRCAFALSSSSTMIVRPPQPYGTVPHSSPDPVTTKISPLRNF
Download sequence
Identical sequences Q49AT5
ENSP00000483180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]