SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483204 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483204
Domain Number 1 Region: 162-236
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000863
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 797-886
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000022
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 3 Region: 716-787
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000961
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSP00000483204
Domain Number - Region: 275-324
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00102
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 643-701
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00259
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 48-132
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00294
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483204   Gene: ENSG00000274779   Transcript: ENST00000620819
Sequence length 1100
Comment pep:known chromosome:GRCh38:CHR_HSCHR16_1_CTG1:15317909:15380166:-1 gene:ENSG00000274779 transcript:ENST00000620819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDG
EPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSG
GYTVIPFYRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEA
VVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATG
FSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVM
VPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSR
QGEKRSLQLSGKVNAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQ
TGYMLRCSLSHAITLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQA
FYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRR
EQQLAEIEARRQEREKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTP
SSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPL
ITVFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDD
QPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEG
QNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRG
LLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSS
EYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYIL
PQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQL
TSRLQGVRALGQAASDNSGPEDAKRQAKKQKTRRTLRLQEEFQLTWCLVPWRGTLGIHLF
SSLPFASEILLETTATCIHY
Download sequence
Identical sequences A0A0G2JP90
ENSP00000483204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]