SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483276 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000483276
Domain Number - Region: 112-172
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0209
Family Cytochrome c3-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483276   Gene: ENSG00000186501   Transcript: ENST00000611517
Sequence length 208
Comment pep:known chromosome:GRCh38:1:27322145:27336399:1 gene:ENSG00000186501 transcript:ENST00000611517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGSSLLLLPPPPPPPRMAEVEAPTAAETDMKQYQGSGGVAMDVERSRFPYCVVWTP
IPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVSEDNMAFGKPAKYWKLDPAQVYASGPNA
WDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWNMVTLCFFCLLYGKYVS
VGAFVKTWLPFILLLGIILTVSLVFNLR
Download sequence
Identical sequences K7ARE9 Q9H0R3
9606.ENSP00000363189 ENSP00000363189 gi|148277052|ref|NP_115501.2| NP_115501.2.87134 NP_115501.2.92137 XP_003809470.1.60992 XP_016812608.1.37143 ENSP00000363189 ENSP00000483276 ENSP00000363189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]