SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483513 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483513
Domain Number 1 Region: 18-216
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.77e-61
Family Eukaryotic proteases 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483513   Gene: ENSG00000142515   Transcript: ENST00000617027
Sequence length 220
Comment pep:known chromosome:GRCh38:19:50854915:50860764:1 gene:ENSG00000142515 transcript:ENST00000617027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSIE
PEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNG
VLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Download sequence
Identical sequences Q8NCW4
ENSP00000483513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]