SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483693 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483693
Domain Number 1 Region: 11-191
Classification Level Classification E-value
Superfamily Rhomboid-like 2.75e-19
Family Rhomboid-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483693   Gene: ENSG00000274437   Transcript: ENST00000620697
Sequence length 235
Comment pep:novel chromosome:GRCh38:CHR_HSCHR22_1_CTG7:23834505:23839012:-1 gene:ENSG00000274437 transcript:ENST00000620697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ
Download sequence
Identical sequences Q96Q80
gi|50845411|ref|NP_001002862.1| ENSP00000315303 ENSP00000483693 ENSP00000315303 NP_001002862.1.87134 NP_001002862.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]