SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483860 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000483860
Domain Number - Region: 20-105
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0471
Family Integrin alpha N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483860   Gene: ENSG00000140678   Transcript: ENST00000562918
Sequence length 181
Comment pep:known chromosome:GRCh38:16:31355174:31358455:1 gene:ENSG00000140678 transcript:ENST00000562918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLLTQRLPVSRQGECR
DHQGFEELTHIQLGVRWARDSLARVDQKEGIWKKSYHVLQWFLTLLPAHPADRPHAAGPF
L
Download sequence
Identical sequences A0A087X131
ENSP00000483860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]