SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484230 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484230
Domain Number 1 Region: 145-263
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.62e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000604
Further Details:      
 
Domain Number 2 Region: 358-519
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 8.37e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00037
Further Details:      
 
Domain Number 3 Region: 52-328
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.58e-22
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484230   Gene: ENSG00000073578   Transcript: ENST00000617470
Sequence length 519
Comment pep:known chromosome:GRCh38:5:218241:256697:1 gene:ENSG00000073578 transcript:ENST00000617470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGER
FMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISE
TAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACAS
VHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGS
IRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVET
LELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKH
TLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPAIRSY
Download sequence
Identical sequences A0A087X1I3
ENSP00000484230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]