SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484846 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000484846
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily DEATH domain 0.0565
Family Pyrin domain, PYD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484846   Gene: ENSG00000273992   Transcript: ENST00000611476
Sequence length 135
Comment pep:known chromosome:GRCh38:CHR_HSCHR19_4_CTG3_1:54974489:54990426:1 gene:ENSG00000273992 transcript:ENST00000611476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKT
EAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERY
KMLIPFSNPRVLPGP
Download sequence
Identical sequences K7EPE6
ENSP00000467349 ENSP00000484846 ENSP00000465006 ENSP00000465919 ENSP00000466920 ENSP00000467349 ENSP00000467554 ENSP00000467940 ENSP00000468170 ENSP00000468661 ENSP00000474313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]