SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484978 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484978
Domain Number 1 Region: 329-403
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000012
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 127-202
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000129
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 964-1053
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000263
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 4 Region: 883-954
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000116
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSP00000484978
Domain Number - Region: 442-494
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00153
Family Carboxypeptidase regulatory domain 0.02
Further Details:      
 
Domain Number - Region: 810-868
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00306
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 215-299
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00353
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00824
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484978   Gene: ENSG00000278087   Transcript: ENST00000616708
Sequence length 1267
Comment pep:known chromosome:GRCh38:CHR_HSCHR16_1_CTG1:16317670:16379913:1 gene:ENSG00000278087 transcript:ENST00000616708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIVATGFSVCGQISIIRFP
DTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKANPGTYKVQVMVPEAETRAGLTLK
PQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
AVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQA
ASDNSGPEDAKRQAKKQKTRRTLRLQEEFQLMWCLVPWRGTLGIHLFSSLPFASEILLET
TATCIHY
Download sequence
Identical sequences J3KN36
ENSP00000263012 ENSP00000484978 ENSP00000263012 XP_005255375.1.92137 ENSP00000263012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]