SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000015877 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000015877
Domain Number 1 Region: 226-301
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.07e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0000282
Further Details:      
 
Domain Number 2 Region: 74-144
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.83e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.000027
Further Details:      
 
Domain Number 3 Region: 412-463
Classification Level Classification E-value
Superfamily Cytokine 0.0000353
Family Interleukin-1 (IL-1) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000015877   Gene: ENSG00000197381   Transcript: ENST00000348831
Sequence length 701
Comment pep:known chromosome:GRCh38:21:45074600:45226560:1 gene:ENSG00000197381 transcript:ENST00000348831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSN
GHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVF
EGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGF
ETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMIL
NELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLH
LDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTG
TDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD
QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQL
RTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPI
YFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSV
NWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHE
SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP
Download sequence
Identical sequences ENSP00000015877 ENSP00000436367 NP_001103.1.87134 NP_001103.1.92137 XP_016883744.1.92137 ENSP00000015877 ENSP00000436367 gi|4501919|ref|NP_001103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]