SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000200557 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000200557
Domain Number 1 Region: 238-436
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.2e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 453-529
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.22e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSP00000200557
Domain Number - Region: 684-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000200557   Gene: ENSG00000073670   Transcript: ENST00000200557
Sequence length 769
Comment pep:known chromosome:GRCh38:17:44759031:44781846:1 gene:ENSG00000073670 transcript:ENST00000200557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRWAFAALLLSLLPTPGLGTQGPAGALRWGGLPQLGGPGAPEVTEPSRLVRESSGG
EVRKQQLDTRVRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSRE
GTTQHSTGAGDHCYYQGKLRGNPHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAP
QGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKY
VELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ
VQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEY
GNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLT
HDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQG
RCYGGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGF
LLCVNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNML
CLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPP
TGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences O75078
ENSP00000200557 9606.ENSP00000200557 NP_002381.2.87134 NP_002381.2.92137 ENSP00000200557 gi|4585710|ref|NP_002381.2| ENSP00000200557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]